PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G102300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 430aa    MW: 46782.6 Da    PI: 5.9482
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G102300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26045.42.4e-1479128150
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalp 50 
                          +CaaCk+++r+C+++C +a y+p ++++kf ++  lFGa+nv+++l++ +
  Manes.07G102300.1.p  79 PCAACKIHGRRCTDKCYVASYLPINEAHKFIVFDGLFGATNVVQFLQNNN 128
                          7*********************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.5978181IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-1279127IPR004883Lateral organ boundaries, LOB
PfamPF023091.8E-5293370IPR033389AUX/IAA domain
SuperFamilySSF542771.77E-5330411No hitNo description
PROSITE profilePS5174518.461335420IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MGKNYCDFSP FLFPSTIVSY DPSSSSSSSS YSSLPLSSPS SPSLNSHFQI SSSLPLHPYS  60
QSSSSSFHPP PPPAAAGGPC AACKIHGRRC TDKCYVASYL PINEAHKFIV FDGLFGATNV  120
VQFLQNNNSS SFIPLLLLLR DSSQEGEPQV DPSLNFVPCG TNQLGAPKNS DHVLTKATTG  180
LECDFLNNLS SGLMFANPKD PQQELPSSSS LVPKRQKLYK VPEDSSQEGE LQADSNMNNV  240
PYGTNIDGQI EAPMNSNHIL TKGTVGLGYD FLNNLSSGVL FANPKHPQQE PPPLMVSKNC  300
GVPNVVSNSI NSTVNLSSIF NRDTSESTPQ LQQKQTFVKI YKSGSFGRKL DIAKFSSYHE  360
LVRELDHIFC LQGKLEDPVR SGWKVVFVDR ENDVILLGDV PWLEFVEGAC AIKLLSPQEV  420
QQMGSHDWL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4chk_A2e-2332742313106AUXIN RESPONSE FACTOR 5
4chk_B2e-2332742313106AUXIN RESPONSE FACTOR 5
4chk_C2e-2332742313106AUXIN RESPONSE FACTOR 5
4chk_D2e-2332742313106AUXIN RESPONSE FACTOR 5
4chk_E2e-2332742313106AUXIN RESPONSE FACTOR 5
4chk_F2e-2332742313106AUXIN RESPONSE FACTOR 5
4chk_G2e-2332742313106AUXIN RESPONSE FACTOR 5
4chk_H2e-2332742313106AUXIN RESPONSE FACTOR 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519813.14e-59PREDICTED: auxin response factor 19
TrEMBLB9S1E45e-59B9S1E4_RICCO; Auxin response factor
STRINGPOPTR_0018s14300.15e-57(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30330.29e-40auxin response factor 6